PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr030739.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family GRAS
Protein Properties Length: 679aa    MW: 74660.1 Da    PI: 5.8205
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr030739.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS421.85.9e-1292946631374
         GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshlta 98 
                  lv+lL++c+ea+  ++ +++++++a+l elasp+g+++ Rl ay+teAL+ r++r +++++++ +p+e +++++ ++  a++l+++vs i+kf h+t 
  Pbr030739.1 294 LVSLLTACVEAIGLKNIAAINHFIAKLGELASPKGSAISRLSAYYTEALSLRVTRLWPHVFQINAPREFDRRDE-DSGIAVRLLNQVSAIPKFVHFTS 390
                  6899*****************************************************************96655.5556779**************** PP

         GRAS  99 NqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrledleleeLrv 196
                  N+ +l+a+eg++rvHiiDfdi+qGlQWp+L+q+La R+++p ++RiTg+g+    sk+el+etg+rLa fA +l++pfef++ v++rled+++++L+v
  Pbr030739.1 391 NEILLRAFEGKDRVHIIDFDIKQGLQWPSLFQSLALRTNPPSHVRITGIGE----SKQELNETGDRLAGFAGALNLPFEFHP-VVDRLEDVRVWMLHV 483
                  ***************************************************....***************************.7************** PP

         GRAS 197 kpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgrei 294
                  k++E++aVn+v+qlh++l + +    + +++L lv+s++P++v ++eqea+hn++++ +r++++l+yysa+fds+ ++lp  s++rikvE++ ++rei
  Pbr030739.1 484 KEHESVAVNCVFQLHKTLYDMTGG--ALRDFLGLVRSTNPTIVLMAEQEAEHNEARLETRVSNSLKYYSAIFDSIGSSLPLGSQARIKVEEM-FAREI 578
                  *****************9554443..4589**************************************************************.***** PP

         GRAS 295 vnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveee.....sgslvlgWkdrpLvsvSaWr 374
                  +n+vaceg++r erhe++ekWr+++e+ GF+ + ++e+++ q + ll++++s+ y v+++      ++l+l W+d+pL++vSaW+
  Pbr030739.1 579 RNIVACEGSDRLERHESFEKWRKWMEQGGFRCAGITEREMLQSQFLLKMYASESYAVKKQeqdgaAEALTLSWMDQPLYTVSAWT 663
                  **********************************************************776667677899**************6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098557.07268638IPR005202Transcription factor GRAS
PfamPF035142.0E-126294663IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 679 aa     Download sequence    Send to blast
MLAGCSSSTL LSPRHRLRSE ATAQLQACSF QLPSMSTQRL DLPCSFPRKD TSRSQPIRPV  60
GLSVEKSIDS KAGSCSLKQS IRLPPLATTG PVSVTAAFVE AGKENRNQFW REKKIGKRFA  120
EPVDDDESCR NRAKRKRGCG DNGGGLGLGQ LGGGNFWFQP GIQLPPRTTQ LPFSLTCSGD  180
DERVCYVPGE AISQPLPLSN SPWLDSIVTE ITDLGKKDGG GEDSRGLVRE ASAASSTSSE  240
SQSLALRVNE SASEHEAGNG TRNPYVPYGG AGVVAEEEED ADDESEAEHL GFELVSLLTA  300
CVEAIGLKNI AAINHFIAKL GELASPKGSA ISRLSAYYTE ALSLRVTRLW PHVFQINAPR  360
EFDRRDEDSG IAVRLLNQVS AIPKFVHFTS NEILLRAFEG KDRVHIIDFD IKQGLQWPSL  420
FQSLALRTNP PSHVRITGIG ESKQELNETG DRLAGFAGAL NLPFEFHPVV DRLEDVRVWM  480
LHVKEHESVA VNCVFQLHKT LYDMTGGALR DFLGLVRSTN PTIVLMAEQE AEHNEARLET  540
RVSNSLKYYS AIFDSIGSSL PLGSQARIKV EEMFAREIRN IVACEGSDRL ERHESFEKWR  600
KWMEQGGFRC AGITEREMLQ SQFLLKMYAS ESYAVKKQEQ DGAAEALTLS WMDQPLYTVS  660
AWTKVDVAGS SSSFSEPS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-432946625374GRAS family transcription factor containing p
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009339647.10.0PREDICTED: scarecrow-like protein 28
SwissprotQ9CAN30.0SCL28_ARATH; Scarecrow-like protein 28
TrEMBLM5WU020.0M5WU02_PRUPE; Uncharacterized protein
STRINGPOPTR_0003s12240.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF91613244
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G63100.10.0GRAS family protein